General Information

  • ID:  hor005643
  • Uniprot ID:  P01182
  • Protein name:  Neurophysin 2
  • Gene name:  AVP
  • Organism:  Equus caballus (Horse)
  • Family:  Vasopressin/oxytocin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0005185 neurohypophyseal hormone activity; GO:0031894 V1A vasopressin receptor binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence Information

  • Sequence:  DLELRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGAGLPRRA
  • Length:  92
  • Propeptide:  DLELRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGAGLPRRA
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neurophysin 2 specifically binds the midbrain peptide hormone vasopressin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  DRD2
  • Target Unid:  P37288
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-51; 10-24; 18-41; 25-31; 58-70; 64-82; 71-76
  • Structure ID:  AF-P01182-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P01182-F1.pdbhor005643_AF2.pdbhor005643_ESM.pdb

Physical Information

Mass: 1112513 Formula: C386H621N121O131S14
Absent amino acids: HMW Common amino acids: GC
pI: 4.55 Basic residues: 9
Polar residues: 39 Hydrophobic residues: 20
Hydrophobicity: -33.26 Boman Index: -15770
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 52.07
Instability Index: 5548.37 Extinction Coefficient cystines: 2365
Absorbance 280nm: 25.99

Literature

  • PubMed ID:  891988
  • Title:  Phylogeny of the neurophysins: complete amino acid sequence of horse MSEL-neurophysin